PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000128464
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 342aa    MW: 36720.4 Da    PI: 9.6412
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000128464genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.72.1e-32244300259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    dD ynWrKYGqK vkgsefprsYY+Ct+ +Cpvkkkver    ++++ei+Y+g+Hnhe
  MDP0000128464 244 DDSYNWRKYGQKLVKGSEFPRSYYKCTHMNCPVKKKVERIP-SGEITEIIYKGQHNHE 300
                    8****************************************.9**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.2E-28234302IPR003657WRKY domain
PROSITE profilePS5081123.583238302IPR003657WRKY domain
SuperFamilySSF1182908.11E-26240302IPR003657WRKY domain
SMARTSM007743.4E-35243301IPR003657WRKY domain
PfamPF031065.1E-25244300IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MTAKTQDSNR VAVSAPPPQK QPQRPVITLP PRPSAEALFS GGSGASPGPM TLVSSFFENY  60
PESDFRSFSQ LLAGAMGSPV GSTRGMNFFS DSPADGLGKS GGGSEYGGEG SSGFKQSRPM  120
SLAVARPPLF TVPPGLSPSG LLNSPGFYSP QSPFGMSHQQ ALAQVTAQAA LAQSRVYMQP  180
DYQPSSVAAP TEPQACQPSL MPEEASRQLT LPSTSDTKSX VRQSSEASHS DGKYQPSSTG  240
RPADDSYNWR KYGQKLVKGS EFPRSYYKCT HMNCPVKKKV ERIPSGEITE IIYKGQHNHE  300
VPQPSKRPKD GDLNGPKPEN GLQRRVGDSN RLSEKYSFSX TT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-162443021877Probable WRKY transcription factor 4
2lex_A2e-162443021877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.126970.0fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP0529390.0KP052939.1 Pyrus pyrifolia WRKY transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008341610.10.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9XI906e-80WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLD9ZJE90.0D9ZJE9_MALDO; WRKY domain class transcription factor
STRINGPOPTR_0017s12430.11e-122(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF154534100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-68WRKY DNA-binding protein 4